PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00009.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 320aa    MW: 35616.5 Da    PI: 6.4106
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00009.1_g00019.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.29.6e-10126175554
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                              kr++r   NR +A rs +RK  +i+eLe++v++L++e ++L  +l   + 
  Rsa1.0_00009.1_g00019.1 126 KRAKRILANRQSAARSKERKARYIQELERRVQSLQTEATTLSAQLTLFQR 175
                              9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-16122186IPR004827Basic-leucine zipper domain
PfamPF077161.3E-7124171IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909124187IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.73E-10126177No hitNo description
Gene3DG3DSA:1.20.5.1702.2E-8126171No hitNo description
CDDcd147031.04E-21127176No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MDDKPDPRPG PNAGSFPSSF HRRSRSDDMS MFMFTDPLIS AAVPPSSDDD LFSSFIDVDS  60
LSSNPNQPIS FPNHASVPPS SSSRPRHRHS NSVDAGCAMY ASDEIMDAKK AMPPEKLSEL  120
WSIDPKRAKR ILANRQSAAR SKERKARYIQ ELERRVQSLQ TEATTLSAQL TLFQRDTNGL  180
ANENTELKLR LQAMEQQAHL RNALNEALRK EVERMKMETG EISSNSDSYD MGMQQVQYSP  240
STFMAIPPYH HGSINNGQDM MQQMRGFNQS RPMEVSNSQS VSEFLQNGRL QGLEISSNNS  300
SSLVKSEGPS LSASESSSAY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4198521e-168AJ419852.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAY0624741e-168AY062474.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850; F4H5.7) mRNA, complete cds.
GenBankBT0001021e-168BT000102.1 Arabidopsis thaliana Similar to bZIP transcription factors (At1g06850) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013657521.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P47e-83RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A078FME00.0A0A078FME0_BRANA; BnaA08g28740D protein
STRINGBra030663.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-118basic leucine-zipper 52